PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000430.1.g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 548aa    MW: 63282.1 Da    PI: 5.0268
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000430.1.g00002.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-18234281148
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     +g+WTteEd++lvd++++ G g+W++ ++  g++R++k+c++rw +yl
  FANhyb_rscf00000430.1.g00002.1 234 KGPWTTEEDQKLVDYINRNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 281
                                     79********************************************97 PP

2Myb_DNA-binding521.7e-16287332148
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                     rg++++eE+  ++++++  G++ W++Ia +++ gRt++++k++w+++l
  FANhyb_rscf00000430.1.g00002.1 287 RGKFSEEEERVIINLHAVVGNK-WSKIATHLP-GRTDNEIKNYWNTHL 332
                                     89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.313229281IPR017930Myb domain
SuperFamilySSF466891.02E-30231328IPR009057Homeodomain-like
SMARTSM007176.6E-14233283IPR001005SANT/Myb domain
PfamPF002492.6E-16234281IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-23235288IPR009057Homeodomain-like
CDDcd001676.03E-9236281No hitNo description
PROSITE profilePS5129428.593282336IPR017930Myb domain
SMARTSM007171.6E-16286334IPR001005SANT/Myb domain
PfamPF002493.6E-15287332IPR001005SANT/Myb domain
CDDcd001677.25E-11289332No hitNo description
Gene3DG3DSA:1.10.10.604.5E-27289336IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MTSPFEKLFL ESEKRNEMTS PFEKLFLESE KRNEMTSPFE KLFLESEKRN EMTSPFEKLF  60
LESEKRNEMT SPFEKLFLES EKRNEMTSPF EKLFLESEKR NEMTSPFEKL FLESEKRNEM  120
TSPFEKLFLE SEKRNEMTSP FEKLFLESEK RNEMTSPFEK LFLESEKRNE MTSPFEKLFL  180
ESEKRNEMTS PFEKLFLESE KRNEMTSPFE KLFLTCTYKT SKSPCCDDQS GLKKGPWTTE  240
EDQKLVDYIN RNGHGSWRAL PKLAGLNRCG KSCRLRWTNY LRPDIKRGKF SEEEERVIIN  300
LHAVVGNKWS KIATHLPGRT DNEIKNYWNT HLRKKLLQMG LDPNTHKPRT DLNHLLNLSQ  360
LLSMASVGNM VTSNPWDNAV SLQASAAQLS KMQLLQNLYM QVINSSIATP DIDNKTGIGP  420
FGSQNINLFG GNFNGASSMV DRDQEWNGAS IPGAPDDLNT MSNTLEGFEG FNSNINNNCY  480
GMQNFKNQYP ELVSSSSPGS STTNNRIEST STSDIPDACQ SSPTSIFEAW ERLMDDDTSE  540
SYWKNILQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-292323365108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301783.20.0PREDICTED: transcription factor MYB39
SwissprotQ8GWP07e-82MYB39_ARATH; Transcription factor MYB39
TrEMBLM5WRB41e-127M5WRB4_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s02240.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-78myb domain protein 9